Structure of PDB 5fci Chain o4

Receptor sequence

>5fcio4 (length=112) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

AQRVTFRRRNPYNTRSNKIKVVKTPGGILRAQHVKKLATRPKCGDCGSAL
QGISTLRPRQYATVSKTHKTVSRAYGGSRCANCVKERIIRAFLIEEQKIV
KKVVKEQTEAAK

3D structure

PDB

Chain

Resolution

3.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	o4	A2 R4 V5 F7 R8 R9 R10 N11 P12 Y13 N14 T15 S17 K19 V22 K24 T25 P26 G27 R31 Q33 K36 K37 L38 T40 R41 P42 K43 Q52 G53 I54 S55 T56 R58 P59 R60 Y62 A63 S66 K67 T68 K70 T71 V72 S73 R74 A75 Y76 G77 G78 S79 R80 N83 R88 R91 A92 I95 E96 Q98 K99 K102	A1 R3 V4 F6 R7 R8 R9 N10 P11 Y12 N13 T14 S16 K18 V21 K23 T24 P25 G26 R30 Q32 K35 K36 L37 T39 R40 P41 K42 Q51 G52 I53 S54 T55 R57 P58 R59 Y61 A62 S65 K66 T67 K69 T70 V71 S72 R73 A74 Y75 G76 G77 S78 R79 N82 R87 R90 A91 I94 E95 Q97 K98 K101
BS02	MG	o4	G53 T68	G52 T67

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0030687	preribosome, large subunit precursor
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5fci, PDBe:5fci, PDBj:5fci
PDBsum	5fci
PubMed	26906928
UniProt	P87262\|RL34A_YEAST Large ribosomal subunit protein eL34A (Gene Name=RPL34A)

[Back to BioLiP]