Structure of PDB 4u50 Chain o4

Receptor sequence

>4u50o4 (length=112) Species: 559292 (Saccharomyces cerevisiae S288C)

AQRVTFRRRNPYNTRSNKIKVVKTPGGILRAQHVKKLATRPKCGDCGSAL
QGISTLRPRQYATVSKTHKTVSRAYGGSRCANCVKERIIRAFLIEEQKIV
KKVVKEQTEAAK

3D structure

• PDB: 4u50 ?
• Chain: o4
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	o4	A2 R4 V5 F7 R8 R9 R10 N11 P12 Y13 N14 T15 S17 V22 V23 K24 T25 P26 G27 R31 Q33 K36 K37 T40 R41 P42 K43 G45 Q52 G53 T56 P59 R60 Y62 A63 T64 S66 K67 T68 K70 T71 S73 R74 Y76 G77 G78 S79 R80 N83 R88 R91 A92 I95 E96 K99 K102	A1 R3 V4 F6 R7 R8 R9 N10 P11 Y12 N13 T14 S16 V21 V22 K23 T24 P25 G26 R30 Q32 K35 K36 T39 R40 P41 K42 G44 Q51 G52 T55 P58 R59 Y61 A62 T63 S65 K66 T67 K69 T70 S72 R73 Y75 G76 G77 S78 R79 N82 R87 R90 A91 I94 E95 K98 K101
BS02	MG	o4	G53 T71	G52 T70

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0030687 preribosome, large subunit precursor
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4u50, PDBe:4u50, PDBj:4u50
• PDBsum: 4u50
• PubMed: 25209664
• UniProt: P87262|RL34A_YEAST Large ribosomal subunit protein eL34A (Gene Name=RPL34A)