Structure of PDB 8b2l Chain o3

Receptor sequence

>8b2lo3 (length=245) Species: 4097 (Nicotiana tabacum) [Search protein sequence]

GRVIRAQRKGAGSVFKSHTHHRKGPAKFRSLDYGERNGYLKGVVSEIIHD
PGRGAPLARVTFRHPFRYKHQKELFVAAEGMYTGQFIYCGKKANLMVGNV
LALRSIPEGAVVCNVEHKVGDRGVFARCSGDYAIVISHNPDNGTTRIKLP
SGAKKIVPSGCRAMIGQVAGGGRTEKPMLKAGNAYHKYRVKRNCWPKVRG
VAMNPVEHPHGGGNHQHIGHASTVRRDAPPGQKVGLIAARRTGRL

3D structure

PDB

8b2l Structure of the actively translating plant 80S ribosome at 2.2 angstrom resolution.

Chain

Resolution

2.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	o3	G2 R3 V4 A7 Q8 R9 K10 G11 S14 V15 S18 H19 T20 H21 H22 R23 G25 P26 S31 Y34 R37 G39 Y40 H50 P52 R54 R64 F67 R68 Y69 K70 H71 T84 G85 F87 Y89 A94 N95 K119 V125 F126 A127 R128 C129 S130 G131 D132 L150 P151 S152 K156 G173 R174 T175 K177 M179 L180 K181 A182 G183 Y186 H187 K188 R190 V191 K192 R193 N194 W196 P197 K198 V199 R200 G201 V202 A203 M204 N205 P206 V207 E208 H209 H211 G213 G214 N215 H216 Q217 H218 G220 H221 A222 S223 T224 V225 R226 R227 D228 P230 P231 G232 Q233 K234 V235 G236 L237 I238 A239 A240 R241 R242 T243 G244 R245	G1 R2 V3 A6 Q7 R8 K9 G10 S13 V14 S17 H18 T19 H20 H21 R22 G24 P25 S30 Y33 R36 G38 Y39 H49 P51 R53 R63 F66 R67 Y68 K69 H70 T83 G84 F86 Y88 A93 N94 K118 V124 F125 A126 R127 C128 S129 G130 D131 L149 P150 S151 K155 G172 R173 T174 K176 M178 L179 K180 A181 G182 Y185 H186 K187 R189 V190 K191 R192 N193 W195 P196 K197 V198 R199 G200 V201 A202 M203 N204 P205 V206 E207 H208 H210 G212 G213 N214 H215 Q216 H217 G219 H220 A221 S222 T223 V224 R225 R226 D227 P229 P230 G231 Q232 K233 V234 G235 L236 I237 A238 A239 R240 R241 T242 G243 R244

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8b2l, PDBe:8b2l, PDBj:8b2l
PDBsum	8b2l
PubMed	37156858
UniProt	A0A1S3XXQ5

[Back to BioLiP]