Structure of PDB 8rcm Chain o2

Receptor sequence

>8rcmo2 (length=51) Species: 562 (Escherichia coli)

RLGRGIGSGLGKTGGRGHKGQKSRSGGGVRRGFEGGQMPLYRRLPKFGFT
S

3D structure

• PDB: 8rcm Transient disome complex formation in native polysomes during ongoing protein synthesis captured by cryo-EM.
• Chain: o2
• Resolution: 3.59 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	o2	R18 L19 R21 G22 I23 G24 G26 K29 G32 R33 G34 H35 G37 Q38 K39 S40 S42 G43 V46 R47 G49 F50 E51 G52 Q54 Y58 R60 L61 P62 K63 F64 G65 F66 T67 S68	R1 L2 R4 G5 I6 G7 G9 K12 G15 R16 G17 H18 G20 Q21 K22 S23 S25 G26 V29 R30 G32 F33 E34 G35 Q37 Y41 R43 L44 P45 K46 F47 G48 F49 T50 S51

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0019843 rRNA binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8rcm, PDBe:8rcm, PDBj:8rcm
• PDBsum: 8rcm
• PubMed: 38409277
• UniProt: P02413|RL15_ECOLI Large ribosomal subunit protein uL15 (Gene Name=rplO)