Structure of PDB 8r3v Chain o2

Receptor sequence

>8r3vo2 (length=51) Species: 562 (Escherichia coli)

RLGRGIGSGLGKTGGRGHKGQKSRSGGGVRRGFEGGQMPLYRRLPKFGFT
S

3D structure

• PDB: 8r3v Transient disome complex formation in native polysomes during ongoing protein synthesis captured by cryo-EM.
• Chain: o2
• Resolution: 3.28 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	o2	R18 L19 G20 R21 G22 I23 G24 S25 G28 K29 T30 G32 R33 G34 H35 K36 Q38 K39 S40 R41 S42 G43 R47 R48 F50 E51 G52 Q54 M55 Y58 R59 R60 L61 P62 K63 F64 G65 F66 T67 S68	R1 L2 G3 R4 G5 I6 G7 S8 G11 K12 T13 G15 R16 G17 H18 K19 Q21 K22 S23 R24 S25 G26 R30 R31 F33 E34 G35 Q37 M38 Y41 R42 R43 L44 P45 K46 F47 G48 F49 T50 S51

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0019843 rRNA binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8r3v, PDBe:8r3v, PDBj:8r3v
• PDBsum: 8r3v
• PubMed: 38409277
• UniProt: P02413|RL15_ECOLI Large ribosomal subunit protein uL15 (Gene Name=rplO)