Structure of PDB 4u52 Chain o2

Receptor sequence

>4u52o2 (length=127) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

ASLPHPKIVKKHTKKFKRHHSDRYHRVAENWRKQKGIDSVVRRRFRGNIS
QPKIGYGSNKKTKFLSPSGHKTFLVANVKDLETLTMHTKTYAAEIAHNIS
AKNRVVILARAKALGIKVTNPKGRLAL

3D structure

PDB

Chain

Resolution

3.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	o2	K11 K12 T14 K15 K16 F17 R19 D23 R24 Y25 R27 V28 N31 W32 R33 K34 K36 G37 I38 D39 S40 V41 R43 R44 R45 F46 R47 G48 P53 K54 I55 G56 Y57 G58 S59 N60 K61 K64 F65 S69 N78 K80 E95 H98 N99 I100 S101 K103 N104 R105 K118 N121 G124 R125	K10 K11 T13 K14 K15 F16 R18 D22 R23 Y24 R26 V27 N30 W31 R32 K33 K35 G36 I37 D38 S39 V40 R42 R43 R44 F45 R46 G47 P52 K53 I54 G55 Y56 G57 S58 N59 K60 K63 F64 S68 N77 K79 E94 H97 N98 I99 S100 K102 N103 R104 K117 N120 G123 R124

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4u52, PDBe:4u52, PDBj:4u52
PDBsum	4u52
PubMed	25209664
UniProt	P38061\|RL32_YEAST Large ribosomal subunit protein eL32 (Gene Name=RPL32)

[Back to BioLiP]