Structure of PDB 6kgx Chain o1

Receptor sequence
>6kgxo1 (length=212) Species: 35688 (Porphyridium purpureum) [Search protein sequence]
AKPPSYSSVDSLRPARVSRMDADWATIYEQVRRQVMGNAYVMEGEAPDID
VAFSQLKGGNLTVREFVRAVGKSASYRTRFMEAKSSYNFVLLNFKHFLGR
APTQEEVSTHIQILATSGLEAEIDSYIDSDEYKALFGDHVVPYVVYRGTY
LSSERFNRMVKANPGGATSDKAKSNLNMIATVAADLPTDAIDVMRGLPSP
ITSETLAFGTAY
3D structure
PDB6kgx Structural basis of energy transfer in Porphyridium purpureum phycobilisome.
Chaino1
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 PEB o1 S60 V62 T202 E207 F209 S7 V9 T149 E154 F156
BS02 PEB o1 S107 Q108 K110 G111 S54 Q55 K57 G58
BS03 PEB o1 S161 I164 S108 I111
BS04 PEB o1 Y93 D223 N228 Y40 D170 N175
BS05 PEB o1 I244 M247 I191 M194
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 18:56:31 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6kgx', asym_id = 'o1', title = 'Structural basis of energy transfer in Porphyridium purpureum phycobilisome.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6kgx', asym_id='o1', title='Structural basis of energy transfer in Porphyridium purpureum phycobilisome.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0015979,0030089', uniprot = '', pdbid = '6kgx', asym_id = 'o1'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0015979,0030089', uniprot='', pdbid='6kgx', asym_id='o1')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>