Structure of PDB 9brd Chain o

Receptor sequence

>9brdo (length=150) Species: 10116 (Rattus norvegicus)

NNPEYSSFFGVMGASSAMVFSAMGAAYGTAKSGTGIAAMSVMRPELIMKS
IIPVVMAGIIAIYGLVVAVLIANSLTDGITLYRSFLQLGAGLSVGLSGLA
AGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK

3D structure

• PDB: 9brd High-resolution electron cryomicroscopy of V-ATPase in native synaptic vesicles.
• Chain: o
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CLR	o	Y144 I147	Y139 I142
BS02	CLR	o	Y68 L146 T154	Y63 L141 T149
BS03	CLR	o	L143 I147 I151 T154	L138 I142 I146 T149
BS04	CLR	o	I67 V71	I62 V66

Gene Ontology

Molecular Function

• GO:0031625 ubiquitin protein ligase binding

Biological Process

• GO:0030177 positive regulation of Wnt signaling pathway
• GO:0070374 positive regulation of ERK1 and ERK2 cascade
• GO:0097401 synaptic vesicle lumen acidification
• GO:1902600 proton transmembrane transport
• GO:1904093 negative regulation of autophagic cell death

Cellular Component

• GO:0000220 vacuolar proton-transporting V-type ATPase, V0 domain
• GO:0008021 synaptic vesicle
• GO:0016020 membrane
• GO:0030665 clathrin-coated vesicle membrane
• GO:0030672 synaptic vesicle membrane
• GO:0031410 cytoplasmic vesicle
• GO:0033176 proton-transporting V-type ATPase complex
• GO:0045202 synapse

External links

• PDB: RCSB:9brd, PDBe:9brd, PDBj:9brd
• PDBsum: 9brd
• PubMed: 38900912
• UniProt: P63081|VATL_RAT V-type proton ATPase 16 kDa proteolipid subunit c (Gene Name=Atp6v0c)