Structure of PDB 8wid Chain o

Receptor sequence
>8wido (length=100) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]
AKKSKIVKNEQRRELVQRYAERRAELKRTIRDPASSPERRAAAVSALQRL
PRDSSPVRLRNRDVVDGRPRGHLRKFGLSRVRVREMAHRGELPGVRKASW
3D structure
PDB8wid Cryo- EM structure of the mycobacterial 70S ribosome in complex with ribosome hibernation promotion factor RafH.
Chaino
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna o A2 K3 K4 S5 K6 K9 R13 R24 R29 R32 L48 R53 S56 V58 R59 R61 R63 D67 R69 R71 H73 R75 R81 V82 R83 R85 K98 S100 W101 A1 K2 K3 S4 K5 K8 R12 R23 R28 R31 L47 R52 S55 V57 R58 R60 R62 D66 R68 R70 H72 R74 R80 V81 R82 R84 K97 S99 W100
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8wid, PDBe:8wid, PDBj:8wid
PDBsum8wid
PubMed38245551
UniProtA0R550|RS14_MYCS2 Small ribosomal subunit protein uS14A (Gene Name=rpsN)

[Back to BioLiP]