Structure of PDB 8v9l Chain o

Receptor sequence
>8v9lo (length=88) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]
ALTAEQKKEILGQYGLHDTDTGSPEAQVALLTKRIQDLTEHLKVHKHDHH
SRRGLLLLVGRRRRLLKYVAQVDVARYRSLIERLGLRR
3D structure
PDB8v9l A new family of bacterial ribosome hibernation factors
Chaino
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna o A2 K8 H18 D21 T22 G23 Q28 R35 L39 H42 H46 H48 D49 H51 S52 R54 R64 R65 Y69 A1 K7 H17 D20 T21 G22 Q27 R34 L38 H41 H45 H47 D48 H50 S51 R53 R63 R64 Y68
BS02 rna o R88 R89 R87 R88
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8v9l, PDBe:8v9l, PDBj:8v9l
PDBsum8v9l
PubMed38355796
UniProtA0QVQ3|RS15_MYCS2 Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]