Structure of PDB 8t5h Chain o

Receptor sequence
>8t5ho (length=82) Species: 562 (Escherichia coli) [Search protein sequence]
MVTIRLARHGAKKRPFYQVVVADSRNARNGRFIERVGFFNPIASEKEEGT
RLDLDRIAHWVGQGATISDRVAALIKEVNKAA
3D structure
PDB8t5h How Dedicated Ribosomes Translate a Leaderless mRNA.
Chaino
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna o M1 T3 R5 L6 R8 H9 K12 K13 R14 F16 Y17 Q18 R25 R28 G30 R31 R35 R51 Q63 S68 R70 A73 K76 M1 T3 R5 L6 R8 H9 K12 K13 R14 F16 Y17 Q18 R25 R28 G30 R31 R35 R51 Q63 S68 R70 A73 K76
External links