Structure of PDB 8qsj Chain o

Receptor sequence
>8qsjo (length=94) Species: 9606 (Homo sapiens) [Search protein sequence]
RGRIPGRQWIGKHRRPRFVSLRAKQNMIRRLEIEAENHYWLSMPYMTREQ
ERGHAAVRRREAFEAIKAAATSKFPPHRFIADQLDHLNVTKKWS
3D structure
PDB8qsj Structural insights into the role of GTPBP10 in the RNA maturation of the mitoribosome.
Chaino
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna o R9 R11 I12 P13 G14 R15 Q16 W17 I18 K20 H21 R23 F26 S28 R30 N34 R56 R60 G61 H62 A63 A64 R66 R67 F71 I74 T79 K81 H94 K100 R1 R3 I4 P5 G6 R7 Q8 W9 I10 K12 H13 R15 F18 S20 R22 N26 R48 R52 G53 H54 A55 A56 R58 R59 F63 I66 T71 K73 H86 K92
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005761 mitochondrial ribosome
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8qsj, PDBe:8qsj, PDBj:8qsj
PDBsum8qsj
PubMed38042949
UniProtQ9BQC6|RT63_HUMAN Large ribosomal subunit protein mL63 (Gene Name=MRPL57)

[Back to BioLiP]