Structure of PDB 8q5i Chain o

Receptor sequence

>8q5io (length=226) Species: 5476 (Candida albicans)

AQQKTAEERAAAKKVRKAANKEKRKVIFDRAAAYQKEYTEAERSVIKAKR
DAKASNSYYVDAQPKLVFVVRIKGINKIPPKPRKVLQLLRLTQINAGVFV
RLTKATSELIKLAEPYVAYGYPSLSTIRQLVYKRGFGKVNKQRIALSDNA
IIEANLGKFNILSIEDLIHEIYTVGPNFKQVSNFLWPFKLSNPNGGFRAR
KFQHFIQGGDTGNREQFINALVKQMN

3D structure

• PDB: 8q5i Structural characterization of cephaeline binding to the eukaryotic ribosome using Cryo-Electron Microscopy
• Chain: o
• Resolution: 2.45 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	o	Q17 R24 A26 R31 N35 R39 R58 R65 K68 K88 G89 I90 N91 K92 P95 K96 R98 K99 L103 R105 Q108 I109 N110 K119 A120 E123 S140 R143 K148 R149 K156 Q157 R158 D163 K194 N198 K204 L205 S206 N207 P208 N209 G210 G211 F212 R215 K216 K238	Q2 R9 A11 R16 N20 R24 R43 R50 K53 K73 G74 I75 N76 K77 P80 K81 R83 K84 L88 R90 Q93 I94 N95 K104 A105 E108 S125 R128 K133 R134 K141 Q142 R143 D148 K179 N183 K189 L190 S191 N192 P193 N194 G195 G196 F197 R200 K201 K223
BS02	rna	o	K126 E129 R215 F217 H219 I221 Q222	K111 E114 R200 F202 H204 I206 Q207

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit

External links

• PDB: RCSB:8q5i, PDBe:8q5i, PDBj:8q5i
• PDBsum: 8q5i
• UniProt: A0A8H6BVN2