Structure of PDB 8pj1 Chain o |
>8pj1o (length=77) Species: 9606 (Homo sapiens) [Search protein sequence] |
NATIRVTNLSEDTRETDLQELFRPFGSISRIYLAKDKTTGQSKGFAFISF HRREDAARAIAGVSGFGYDHLILNVEW |
|
PDB | 8pj1 Structural basis for translational control by the human 48S initiation complex from codon scanning toward subunit joining |
Chain | o |
Resolution | 3.4 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
o |
K280 F282 F284 |
K43 F45 F47 |
|
|
|