Structure of PDB 8p2h Chain o

Receptor sequence
>8p2ho (length=60) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
AKTSMVAKQQKKQKYAVREYTRCERCGRPHSVYRKFKLCRICFRELAYKG
QIPGVRKASW
3D structure
PDB8p2h Staphylococcus aureus 70S ribosome with elongation factor G locked with fusidic acid with a tRNA in pe/E chimeric hybrid state
Chaino
Resolution2.49 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna o A2 K3 T4 S5 M6 A8 K9 K12 K15 Y16 A17 V18 R19 Y21 T22 R23 C27 R29 H31 S32 V33 R35 R41 I42 R45 K58 S60 W61 A1 K2 T3 S4 M5 A7 K8 K11 K14 Y15 A16 V17 R18 Y20 T21 R22 C26 R28 H30 S31 V32 R34 R40 I41 R44 K57 S59 W60
BS02 ZN o C24 C27 C40 C43 C23 C26 C39 C42
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8p2h, PDBe:8p2h, PDBj:8p2h
PDBsum8p2h
PubMed38902339
UniProtQ2FW19|RS14Z_STAA8 Small ribosomal subunit protein uS14B (Gene Name=rpsZ)

[Back to BioLiP]