Structure of PDB 8eup Chain o

Receptor sequence
>8eupo (length=136) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence]
KKGVLYVGRLPHGFYEKQMRMYFSQFGPVLRLRMSRNRKTGSSKHYAFIE
FESLDVANVVAETMHNYLLYGKLLQCKVIPEDQVHENMFKGADVPFKRIP
HATIARLQHEKPLSKEKADKLITRHNRKLKLKKRKL
3D structure
PDB8eup Chromatin localization of nucleophosmin organizes ribosome biogenesis.
Chaino
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna o Y108 R111 M136 R138 N139 R140 S144 S145 K146 H147 Y148 N189 M190 V196 P197 F198 K199 R200 H203 A204 A207 Q210 H211 Y6 R9 M34 R36 N37 R38 S42 S43 K44 H45 Y46 N87 M88 V94 P95 F96 K97 R98 H101 A102 A105 Q108 H109
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:1902626 assembly of large subunit precursor of preribosome
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8eup, PDBe:8eup, PDBj:8eup
PDBsum8eup
PubMed36423630
UniProtO74978|YQL5_SCHPO Uncharacterized RNA-binding protein C1827.05c (Gene Name=SPCC1827.05c)

[Back to BioLiP]