Structure of PDB 8esq Chain o

Receptor sequence

>8esqo (length=137) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence]

KKKGVLYVGRLPHGFYEKQMRMYFSQFGPVLRLRMSRNRKTGSSKHYAFI
EFESLDVANVVAETMHNYLLYGKLLQCKVIPEDQVHENMFKGADVPFKRI
PHATIARLQHEKPLSKEKADKLITRHNRKLKLKKRKL

3D structure

PDB

8esq Chromatin localization of nucleophosmin organizes ribosome biogenesis.

Chain

Resolution

2.8 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	o	Y108 R111 Y117 E118 K119 R135 M136 S137 R138 N139 R140 K141 S144 S145 K146 H147 Y148 Y172 K174 K179 H187 M190 K192 V196 P197 F198 K199 R200 I201 P202 H203 T205 L209 Q210 H211 K219 L223 K234	Y7 R10 Y16 E17 K18 R34 M35 S36 R37 N38 R39 K40 S43 S44 K45 H46 Y47 Y71 K73 K78 H86 M89 K91 V95 P96 F97 K98 R99 I100 P101 H102 T104 L108 Q109 H110 K118 L122 K133

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding

	Biological Process
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:1902626	assembly of large subunit precursor of preribosome

	Cellular Component
GO:0005634	nucleus
GO:0005730	nucleolus

External links

PDB	RCSB:8esq, PDBe:8esq, PDBj:8esq
PDBsum	8esq
PubMed	36423630
UniProt	O74978\|YQL5_SCHPO Uncharacterized RNA-binding protein C1827.05c (Gene Name=SPCC1827.05c)