Structure of PDB 8c3a Chain o

Receptor sequence

>8c3ao (length=234) Species: 5476 (Candida albicans) [Search protein sequence]

ETLQKKEKAQQKTAEERAAAKKVRKAANKEKRKVIFDRAAAYQKEYTEAE
RSVIKAKRDAKASNSYYVDAQPKLVFVVRIKGINKIPPKPRKVLQLLRLT
QINAGVFVRLTKATSELIKLAEPYVAYGYPSLSTIRQLVYKRGFGKVNKQ
RIALSDNAIIEANLGKFNILSIEDLIHEIYTVGPNFKQVSNFLWPFKLSN
PNGGFRARKFQHFIQGGDTGNREQFINALVKQMN

3D structure

PDB

8c3a New crystal system to promote screening for new eukaryotic inhibitors

Chain

Resolution

3.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	o	Q17 R24 K29 R31 K32 N35 R39 R58 R65 K68 K88 G89 I90 N91 K92 P95 K96 K99 L103 R105 Q108 I109 N110 A120 E123 S140 R143 K148 R149 K156 Q157 R158 D163 K194 N198 K204 L205 S206 N207 P208 N209 G210 G211 F212 R215 K216 F217 K238	Q10 R17 K22 R24 K25 N28 R32 R51 R58 K61 K81 G82 I83 N84 K85 P88 K89 K92 L96 R98 Q101 I102 N103 A113 E116 S133 R136 K141 R142 K149 Q150 R151 D156 K187 N191 K197 L198 S199 N200 P201 N202 G203 G204 F205 R208 K209 F210 K231
BS02	rna	o	K126 E129 R215 F217 Q218 H219 I221 Q222	K119 E122 R208 F210 Q211 H212 I214 Q215

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8c3a, PDBe:8c3a, PDBj:8c3a
PDBsum	8c3a
PubMed
UniProt	A0A8H6BVN2

[Back to BioLiP]