Structure of PDB 8buu Chain o

Receptor sequence
>8buuo (length=87) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
ITQERKNQLINEFKTHESDTGSPEVQIAILTDSINNLNEHLRTHKKDHHS
RRGLLKMVGKRRNLLTYLRNKDVTRYRELINKLGLRR
3D structure
PDB8buu Genome-encoded ABCF factors implicated in intrinsic antibiotic resistance in Gram-positive bacteria: VmlR2, Ard1 and CplR.
Chaino
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna o V60 R63 R88 V58 R61 R86
BS02 rna o K8 H18 S20 D21 T22 G23 S24 Q28 N38 L39 H42 H46 K48 D49 H50 H51 S52 R54 G55 K58 K62 N65 Y69 K73 K6 H16 S18 D19 T20 G21 S22 Q26 N36 L37 H40 H44 K46 D47 H48 H49 S50 R52 G53 K56 K60 N63 Y67 K71
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8buu, PDBe:8buu, PDBj:8buu
PDBsum8buu
PubMed36951104
UniProtP21473|RS15_BACSU Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]