Structure of PDB 8bh6 Chain o

Receptor sequence
>8bh6o (length=88) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
AISQERKNEIIKEYRVHETDTGSPEVQIAVLTAEINAVNEHLRTHKKDHH
SRRGLLKMVGRRRHLLNYLRSKDIQRYRELIKSLGIRR
3D structure
PDB8bh6 Ribosome maturation factor P (RimP) from Staphylococcus aureus
Chaino
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna o A2 D21 T22 G23 S24 Q28 V39 H42 K48 D49 H51 R54 L57 K58 M59 R62 H65 Y69 A1 D20 T21 G22 S23 Q27 V38 H41 K47 D48 H50 R53 L56 K57 M58 R61 H64 Y68
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8bh6, PDBe:8bh6, PDBj:8bh6
PDBsum8bh6
PubMed
UniProtQ2G2Q1|RS15_STAA8 Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]