Structure of PDB 7v08 Chain o

Receptor sequence
>7v08o (length=133) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence]
EYSGIIYVSRLPHGFHEKELSKYFAQFGDLKEVRLARNKKTGNSRHYGFL
EFVNKEDAMIAQESMNNYLLMGHLLQVRVLPKGAKIEKLYKYKKRVLVEK
GITKPVKQLKDNMKQKHEERIKKLAKSGIEFKW
3D structure
PDB7v08 rRNA methylation by Spb1 regulates the GTPase activity of Nog2 during 60S ribosomal subunit assembly.
Chaino
Resolution2.36 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna o Y94 R97 R124 N125 K126 N130 S131 R132 H133 Y134 F136 M158 H160 I173 E174 K175 L176 Y179 I189 R207 Y7 R10 R37 N38 K39 N43 S44 R45 H46 Y47 F49 M71 H73 I86 E87 K88 L89 Y92 I102 R120
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0042254 ribosome biogenesis
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0030687 preribosome, large subunit precursor
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7v08, PDBe:7v08, PDBj:7v08
PDBsum7v08
PubMed36864048
UniProtP53927|NOP15_YEAST Ribosome biogenesis protein 15 (Gene Name=NOP15)

[Back to BioLiP]