Structure of PDB 7uoo Chain o

Receptor sequence

>7uooo (length=133) Species: 1247190 (Saccharomyces cerevisiae BY4741)

EYSGIIYVSRLPHGFHEKELSKYFAQFGDLKEVRLARNKKTGNSRHYGFL
EFVNKEDAMIAQESMNNYLLMGHLLQVRVLPKGAKIEKLYKYKKRVLVEK
GITKPVKQLKDNMKQKHEERIKKLAKSGIEFKW

3D structure

• PDB: 7uoo rRNA methylation by Spb1 regulates the GTPase activity of Nog2 during 60S ribosomal subunit assembly.
• Chain: o
• Resolution: 2.34 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	o	Y94 R97 H100 R124 N125 K126 N130 S131 R132 H133 Y134 F136 M158 H160 L167 I173 E174 K175 L176 Y179 I189 K203 R207	Y7 R10 H13 R37 N38 K39 N43 S44 R45 H46 Y47 F49 M71 H73 L80 I86 E87 K88 L89 Y92 I102 K116 R120

Gene Ontology

Molecular Function

• GO:0003674 molecular_function
• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0005515 protein binding
• GO:0019843 rRNA binding

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006364 rRNA processing
• GO:0042254 ribosome biogenesis
• GO:0042273 ribosomal large subunit biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0030687 preribosome, large subunit precursor
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7uoo, PDBe:7uoo, PDBj:7uoo
• PDBsum: 7uoo
• PubMed: 36864048
• UniProt: P53927|NOP15_YEAST Ribosome biogenesis protein 15 (Gene Name=NOP15)