Structure of PDB 7unr Chain o

Receptor sequence
>7unro (length=88) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence]
ALSVEEKAQIVNEYKQAEGDTGSPEVQVALLSANINKLQDHFKANGKDHH
SRRGLIRMVNQRRKLLDYLKGKDVSRYTALIGRLGLRR
3D structure
PDB7unr Compact IF2 allows initiator tRNA accommodation into the P site and gates the ribosome to elongation
Chaino
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna o A2 K8 D21 T22 G23 Q28 H42 N46 K48 D49 H51 S52 R54 R58 N61 K65 Y69 A1 K7 D20 T21 G22 Q27 H41 N45 K47 D48 H50 S51 R53 R57 N60 K64 Y68
BS02 rna o Q40 L56 V60 R88 Q39 L55 V59 R87
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7unr, PDBe:7unr, PDBj:7unr
PDBsum7unr
PubMed
UniProtQ9HV58|RS15_PSEAE Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]