Structure of PDB 7ryg Chain o

Receptor sequence
>7rygo (length=88) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence]
ALTNADRAEIIAKFARAENDTGSPEVQVALLTAQINDLQGHFKAHKHDHH
SRRGLIRMVNQRRKLLDYLNGKDHERYTALIGALGLRR
3D structure
PDB7ryg An Analysis of the Novel Fluorocycline TP-6076 Bound to Both the Ribosome and Multidrug Efflux Pump AdeJ from Acinetobacter baumannii.
Chaino
Resolution2.38 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna o Q40 K44 R53 Q39 K43 R52
BS02 rna o A2 R8 N20 D21 T22 G23 Q28 H42 H46 K47 H48 D49 H51 S52 R54 R58 K65 Y69 K73 A1 R7 N19 D20 T21 G22 Q27 H41 H45 K46 H47 D48 H50 S51 R53 R57 K64 Y68 K72
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ryg, PDBe:7ryg, PDBj:7ryg
PDBsum7ryg
PubMed35100868
UniProtB7I3U0|RS15_ACIB5 Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]