Structure of PDB 7qh6 Chain o

Receptor sequence
>7qh6o (length=91) Species: 9606 (Homo sapiens) [Search protein sequence]
IPGRQWIGKHRRPRFVSLRAKQNMIRRLEIEAENHYWLSMPYMTREQERG
HAAVRRREAFEAIKAAATSKFPPHRFIADQLDHLNVTKKWS
3D structure
PDB7qh6 A late-stage assembly checkpoint of the human mitochondrial ribosome large subunit.
Chaino
Resolution3.08 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna o P13 R15 Q16 W17 F26 S28 R30 A31 N34 R37 R38 R56 R60 G61 H62 A63 A64 R66 R67 F71 I74 H94 P2 R4 Q5 W6 F15 S17 R19 A20 N23 R26 R27 R45 R49 G50 H51 A52 A53 R55 R56 F60 I63 H83
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005761 mitochondrial ribosome
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qh6, PDBe:7qh6, PDBj:7qh6
PDBsum7qh6
PubMed35177605
UniProtQ9BQC6|RT63_HUMAN Large ribosomal subunit protein mL63 (Gene Name=MRPL57)

[Back to BioLiP]