Structure of PDB 7q0p Chain o

Receptor sequence

>7q0po (length=234) Species: 237561 (Candida albicans SC5314)

ETLQKKEKAQQKTAEERAAAKKVRKAANKEKRKVIFDRAAAYQKEYTEAE
RSVIKAKRDAKASNSYYVDAQPKLVFVVRIKGINKIPPKPRKVLQLLRLT
QINAGVFVRLTKATSELIKLAEPYVAYGYPSLSTIRQLVYKRGFGKVNKQ
RIALSDNAIIEANLGKFNILSIEDLIHEIYTVGPNFKQVSNFLWPFKLSN
PNGGFRARKFQHFIQGGDTGNREQFINALVKQMN

3D structure

• PDB: 7q0p E-site drug specificity of the human pathogen Candida albicans ribosome.
• Chain: o
• Resolution: 2.77 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	o	Q17 R24 R31 N35 R39 R58 R65 K68 K88 G89 I90 N91 K92 P95 K96 R98 K99 L103 R105 Q108 I109 N110 K119 A120 E123 L124 S140 R143 K148 R149 K156 Q157 R158 D163 K194 N198 K204 L205 S206 N207 P208 N209 G210 G211 F212 R215 K216 F217 K238	Q10 R17 R24 N28 R32 R51 R58 K61 K81 G82 I83 N84 K85 P88 K89 R91 K92 L96 R98 Q101 I102 N103 K112 A113 E116 L117 S133 R136 K141 R142 K149 Q150 R151 D156 K187 N191 K197 L198 S199 N200 P201 N202 G203 G204 F205 R208 K209 F210 K231
BS02	rna	o	K126 E129 R215 F217 H219 I221 Q222	K119 E122 R208 F210 H212 I214 Q215

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0009986 cell surface
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7q0p, PDBe:7q0p, PDBj:7q0p
• PDBsum: 7q0p
• PubMed: 35613268
• UniProt: A0A1D8PDL6|RL7A_CANAL Large ribosomal subunit protein uL30 (Gene Name=RPL7A)