Structure of PDB 7pjy Chain o

Receptor sequence
>7pjyo (length=88) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
SLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHH
SRRGLLRMVSQRRKLLDYLKRKDVARYTQLIERLGLRR
3D structure
PDB7pjy Structural mechanism of GTPase-powered ribosome-tRNA movement.
Chaino
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna o Q39 L55 L56 V59 R88 Q39 L55 L56 V59 R88
BS02 rna o T4 R16 N19 D20 T21 G22 S23 Q27 H37 L38 H41 H45 D48 H49 H50 S51 R53 G54 K64 Y68 K72 T4 R16 N19 D20 T21 G22 S23 Q27 H37 L38 H41 H45 D48 H49 H50 S51 R53 G54 K64 Y68 K72
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006417 regulation of translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pjy, PDBe:7pjy, PDBj:7pjy
PDBsum7pjy
PubMed34635670
UniProtP0ADZ4|RS15_ECOLI Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]