Structure of PDB 7pir Chain o

Receptor sequence
>7piro (length=115) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]
KINKQALIDLVEQKQLKAYVPEFSAGDEVNVAIKLKEKEKVRIQNFTGTV
LRRRGKGISETFIVRKTTDGIPIEKNFQIHNPNISIELKRRGKVRRAYIS
YMRERSGKAAKIKER
3D structure
PDB7pir Visualizing translation dynamics at atomic detail inside a bacterial cell.
Chaino
Resolution12.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna o K6 Q7 E24 F25 S26 R54 R56 G57 K58 S61 T63 N78 Q80 K95 V96 R97 R98 A99 Y100 I101 S102 Y103 K4 Q5 E22 F23 S24 R52 R54 G55 K56 S59 T61 N76 Q78 K93 V94 R95 R96 A97 Y98 I99 S100 Y101
BS02 rna o E39 E41 K42 K110 I114 R117 E37 E39 K40 K108 I112 R115
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pir, PDBe:7pir, PDBj:7pir
PDBsum7pir
PubMed36171285
UniProtP75133|RL19_MYCPN Large ribosomal subunit protein bL19 (Gene Name=rplS)

[Back to BioLiP]