Structure of PDB 7pib Chain o

Receptor sequence
>7pibo (length=115) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]
KINKQALIDLVEQKQLKAYVPEFSAGDEVNVAIKLKEKEKVRIQNFTGTV
LRRRGKGISETFIVRKTTDGIPIEKNFQIHNPNISIELKRRGKVRRAYIS
YMRERSGKAAKIKER
3D structure
PDB7pib Visualizing translation dynamics at atomic detail inside a bacterial cell.
Chaino
Resolution4.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna o K6 Q7 R54 R56 K58 S61 T63 N78 R97 R98 A99 R107 K4 Q5 R52 R54 K56 S59 T61 N76 R95 R96 A97 R105
BS02 rna o R44 R92 S108 G109 K110 A111 A112 R42 R90 S106 G107 K108 A109 A110
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pib, PDBe:7pib, PDBj:7pib
PDBsum7pib
PubMed36171285
UniProtP75133|RL19_MYCPN Large ribosomal subunit protein bL19 (Gene Name=rplS)

[Back to BioLiP]