Structure of PDB 7p7t Chain o

Receptor sequence
>7p7to (length=60) Species: 1351 (Enterococcus faecalis) [Search protein sequence]
AKKSMIAKNKRPAKHSTQAYTRCERCGRPHSVYRKFHLCRICFRELAYKG
QIPGVKKASW
3D structure
PDB7p7t Structural basis for PoxtA-mediated resistance to phenicol and oxazolidinone antibiotics.
Chaino
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna o A2 K3 K4 S5 M6 A8 K9 K15 H16 S17 T18 Q19 Y21 R23 C27 R29 H31 S32 R35 R41 I42 R45 K58 S60 W61 A1 K2 K3 S4 M5 A7 K8 K14 H15 S16 T17 Q18 Y20 R22 C26 R28 H30 S31 R34 R40 I41 R44 K57 S59 W60
BS02 ZN o C24 C27 C40 C43 C23 C26 C39 C42
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0019843 rRNA binding
GO:0046872 metal ion binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7p7t, PDBe:7p7t, PDBj:7p7t
PDBsum7p7t
PubMed35387982
UniProtA0A1B4XKT0

[Back to BioLiP]