Structure of PDB 7p7s Chain o

Receptor sequence

>7p7so (length=60) Species: 1351 (Enterococcus faecalis) [Search protein sequence]

AKKSMIAKNKRPAKHSTQAYTRCERCGRPHSVYRKFHLCRICFRELAYKG
QIPGVKKASW

3D structure

PDB

7p7s Structural basis for PoxtA-mediated resistance to phenicol and oxazolidinone antibiotics.

Chain

Resolution

3.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	o	A2 K3 K4 S5 M6 A8 K9 R12 K15 H16 T18 Q19 Y21 R23 R29 H31 S32 R35 R41 I42 R45 K58 S60 W61	A1 K2 K3 S4 M5 A7 K8 R11 K14 H15 T17 Q18 Y20 R22 R28 H30 S31 R34 R40 I41 R44 K57 S59 W60
BS02	ZN	o	C24 C27 C40 C43	C23 C26 C39 C42

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0008270	zinc ion binding
GO:0019843	rRNA binding
GO:0046872	metal ion binding

	Biological Process
GO:0006412	translation

External links