Structure of PDB 7oid Chain o

Receptor sequence

>7oido (length=93) Species: 9606 (Homo sapiens)

GRIPGRQWIGKHRRPRFVSLRAKQNMIRRLEIEAENHYWLSMPYMTREQE
RGHAAVRRREAFEAIKAAATSKFPPHRFIADQLDHLNVTKKWS

3D structure

• PDB: 7oid A distinct assembly pathway of the human 39S late pre-mitoribosome.
• Chain: o
• Resolution: 3.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	o	R11 I12 P13 G14 R15 Q16 W17 I18 G19 K20 H21 R22 R23 R25 F26 R30 N34 R38 R56 R60 G61 H62 A63 R66 R67 F71 I74 K75 A78 T79 K81 R86 H94	R2 I3 P4 G5 R6 Q7 W8 I9 G10 K11 H12 R13 R14 R16 F17 R21 N25 R29 R47 R51 G52 H53 A54 R57 R58 F62 I65 K66 A69 T70 K72 R77 H85

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005761 mitochondrial ribosome
• GO:0005762 mitochondrial large ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7oid, PDBe:7oid, PDBj:7oid
• PDBsum: 7oid
• PubMed: 34315873
• UniProt: Q9BQC6|RT63_HUMAN Large ribosomal subunit protein mL63 (Gene Name=MRPL57)