Structure of PDB 7oi7 Chain o

Receptor sequence

>7oi7o (length=79) Species: 9606 (Homo sapiens)

PRFVSLRAKQNMIRRLEIEAENHYWLSMPYMTREQERGHAAVRRREAFEA
IKAAATSKFPPHRFIADQLDHLNVTKKWS

3D structure

• PDB: 7oi7 A distinct assembly pathway of the human 39S late pre-mitoribosome.
• Chain: o
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	o	R25 F26 S28 R30 A31 N34 R38 R56 E59 R60 G61 H62 A63 A64 R67 F71 K75 T79 K81 R86 H94	R2 F3 S5 R7 A8 N11 R15 R33 E36 R37 G38 H39 A40 A41 R44 F48 K52 T56 K58 R63 H71

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005761 mitochondrial ribosome
• GO:0005762 mitochondrial large ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7oi7, PDBe:7oi7, PDBj:7oi7
• PDBsum: 7oi7
• PubMed: 34315873
• UniProt: Q9BQC6|RT63_HUMAN Large ribosomal subunit protein mL63 (Gene Name=MRPL57)