Structure of PDB 7oi6 Chain o

Receptor sequence
>7oi6o (length=79) Species: 9606 (Homo sapiens) [Search protein sequence]
PRFVSLRAKQNMIRRLEIEAENHYWLSMPYMTREQERGHAAVRRREAFEA
IKAAATSKFPPHRFIADQLDHLNVTKKWS
3D structure
PDB7oi6 A distinct assembly pathway of the human 39S late pre-mitoribosome.
Chaino
Resolution5.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna o R60 G61 A63 F71 R37 G38 A40 F48
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005761 mitochondrial ribosome
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7oi6, PDBe:7oi6, PDBj:7oi6
PDBsum7oi6
PubMed34315873
UniProtQ9BQC6|RT63_HUMAN Large ribosomal subunit protein mL63 (Gene Name=MRPL57)

[Back to BioLiP]