Structure of PDB 7of2 Chain o

Receptor sequence

>7of2o (length=94) Species: 9606 (Homo sapiens)

RGRIPGRQWIGKHRRPRFVSLRAKQNMIRRLEIEAENHYWLSMPYMTREQ
ERGHAAVRRREAFEAIKAAATSKFPPHRFIADQLDHLNVTKKWS

3D structure

• PDB: 7of2 Structural basis of GTPase-mediated mitochondrial ribosome biogenesis and recycling.
• Chain: o
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	o	R9 R11 I12 P13 G14 R15 Q16 W17 I18 G19 K20 H21 R22 R23 R25 F26 S28 R30 A31 N34 R38 R56 R60 G61 H62 A63 A64 R66 R67 F71 I74 K75 T79 K81 R86 H94 K100	R1 R3 I4 P5 G6 R7 Q8 W9 I10 G11 K12 H13 R14 R15 R17 F18 S20 R22 A23 N26 R30 R48 R52 G53 H54 A55 A56 R58 R59 F63 I66 K67 T71 K73 R78 H86 K92

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005761 mitochondrial ribosome
• GO:0005762 mitochondrial large ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7of2, PDBe:7of2, PDBj:7of2
• PDBsum: 7of2
• PubMed: 34135319
• UniProt: Q9BQC6|RT63_HUMAN Large ribosomal subunit protein mL63 (Gene Name=MRPL57)