Structure of PDB 7nsp Chain o

Receptor sequence

>7nspo (length=88) Species: 562 (Escherichia coli)

SLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHH
SRRGLLRMVSQRRKLLDYLKRKDVARYTQLIERLGLRR

3D structure

• PDB: 7nsp Structural and mechanistic basis for translation inhibition by macrolide and ketolide antibiotics.
• Chain: o
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	o	Q40 L56 L57 V60 R88	Q39 L55 L56 V59 R87
BS02	rna	o	S2 T5 D21 T22 G23 S24 Q28 L31 H42 H46 K48 D49 H50 H51 S52 R54 Q62 K65 Y69 R72	S1 T4 D20 T21 G22 S23 Q27 L30 H41 H45 K47 D48 H49 H50 S51 R53 Q61 K64 Y68 R71

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 01:22:33 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7nsp', asym_id = 'o', title = 'Structural and mechanistic basis for translation inhibition by macrolide and ketolide antibiotics.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7nsp', asym_id='o', title='Structural and mechanistic basis for translation inhibition by macrolide and ketolide antibiotics.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '7nsp', asym_id = 'o'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='7nsp', asym_id='o')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>