Structure of PDB 7msz Chain o

Receptor sequence
>7mszo (length=87) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence]
ALTAEQKKEILRSYGLHETDTGSPEAQIALLTKRIADLTEHLKVHKHDHH
SRRGLLLLVGRRRRLIKYISQIDVERYRSLIERLGLR
3D structure
PDB7msz Interplay between an ATP-binding cassette F protein and the ribosome from Mycobacterium tuberculosis.
Chaino
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna o L56 V60 R63 R88 L55 V59 R62 R87
BS02 rna o K8 H18 D21 T22 G23 Q28 R35 H42 H48 D49 H51 S52 R54 R62 R65 Y69 K7 H17 D20 T21 G22 Q27 R34 H41 H47 D48 H50 S51 R53 R61 R64 Y68
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0005886 plasma membrane
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7msz, PDBe:7msz, PDBj:7msz
PDBsum7msz
PubMed35064151
UniProtP9WH55|RS15_MYCTU Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]