Structure of PDB 7f9o Chain o

Receptor sequence
>7f9oo (length=146) Species: 77009 (Hordeum vulgare subsp. spontaneum) [Search protein sequence]
SLETPVTSSPLVAWYLSNLPAYRTAVSPLLRGIEVGLAHGYLLVGPFALT
GPLRNTPVHGQAGTLGAIGLVSILSVCLTMYGVASFNEGEPSTAPVLTLT
GRKKEADKLQTAEGWSQFTGGFFFGGVSGAVWAYFLLYVLDLPYFF
3D structure
PDB7f9o Architecture of the chloroplast PSI-NDH supercomplex in Hordeum vulgare.
Chaino
Resolution4.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA o T66 V68 V74 T4 V6 V12
BS02 CLA o T112 G113 P114 T50 G51 P52
BS03 CLA o N80 R85 E96 N18 R23 E34
BS04 CLA o Y77 P82 A83 V97 H101 L104 Y15 P20 A21 V35 H39 L42
BS05 CLA o Y103 L104 G107 P108 L199 Y206 F207 Y41 L42 G45 P46 L137 Y144 F145
Gene Ontology
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009535 chloroplast thylakoid membrane
GO:0009538 photosystem I reaction center
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7f9o, PDBe:7f9o, PDBj:7f9o
PDBsum7f9o
PubMed34879391
UniProtP23993|PSAL_HORVU Photosystem I reaction center subunit XI, chloroplastic (Gene Name=PSAL)

[Back to BioLiP]