Structure of PDB 6zsb Chain o

Receptor sequence
>6zsbo (length=94) Species: 9606 (Homo sapiens) [Search protein sequence]
RGRIPGRQWIGKHRRPRFVSLRAKQNMIRRLEIEAENHYWLSMPYMTREQ
ERGHAAVRRREAFEAIKAAATSKFPPHRFIADQLDHLNVTKKWS
3D structure
PDB6zsb Structural basis of mitochondrial translation.
Chaino
Resolution4.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna o R9 R11 I12 P13 G14 R15 Q16 W17 G19 K20 H21 R23 R25 F26 S28 R30 A31 N34 R38 R56 R60 A63 A64 R66 R67 F71 K75 T79 K81 R86 H94 R1 R3 I4 P5 G6 R7 Q8 W9 G11 K12 H13 R15 R17 F18 S20 R22 A23 N26 R30 R48 R52 A55 A56 R58 R59 F63 K67 T71 K73 R78 H86
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005761 mitochondrial ribosome
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6zsb, PDBe:6zsb, PDBj:6zsb
PDBsum6zsb
PubMed32812867
UniProtQ9BQC6|RT63_HUMAN Large ribosomal subunit protein mL63 (Gene Name=MRPL57)

[Back to BioLiP]