Structure of PDB 6yly Chain o

Receptor sequence
>6ylyo (length=125) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
EYSGIIYVSRLPHGFHEKELSKYFAQFGDLKEVRLARNKKTGNSRHYGFL
EFVNKEDAMIAQESMNNYLLMGHLLQVRVLPKGAKIEKLYKYKKRVPVKQ
LKDNMKQKHEERIKKLAKSGIEFKW
3D structure
PDB6yly Construction of the Central Protuberance and L1 Stalk during 60S Subunit Biogenesis.
Chaino
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna o Y94 R97 H100 R124 N125 K126 N130 R132 H133 Y134 F136 L157 H160 E174 K175 L176 Y177 Y179 K181 K203 R207 Y7 R10 H13 R37 N38 K39 N43 R45 H46 Y47 F49 L70 H73 E87 K88 L89 Y90 Y92 K94 K108 R112
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0042254 ribosome biogenesis
GO:0042273 ribosomal large subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0030687 preribosome, large subunit precursor
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6yly, PDBe:6yly, PDBj:6yly
PDBsum6yly
PubMed32668200
UniProtP53927|NOP15_YEAST Ribosome biogenesis protein 15 (Gene Name=NOP15)

[Back to BioLiP]