Structure of PDB 6yef Chain o

Receptor sequence
>6yefo (length=88) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
AISQERKNEIIKEYRVHETDTGSPEVQIAVLTAEINAVNEHLRTHKKDHH
SRRGLLKMVGRRRHLLNYLRSKDIQRYRELIKSLGIRR
3D structure
PDB6yef Cryo-EM structure of the ribosome functional complex of the human pathogen Staphylococcus aureus at 3.2 angstrom resolution.
Chaino
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna o N9 T20 T22 G23 Q28 V39 H42 H46 K48 D49 H51 S52 R54 K58 M59 R64 H65 Y69 N8 T19 T21 G22 Q27 V38 H41 H45 K47 D48 H50 S51 R53 K57 M58 R63 H64 Y68
BS02 rna o L56 V60 R89 L55 V59 R88
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6yef, PDBe:6yef, PDBj:6yef
PDBsum6yef
PubMed32852796
UniProtQ2G2Q1|RS15_STAA8 Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]