Structure of PDB 6v39 Chain o

Receptor sequence
>6v39o (length=88) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence]
ALTNADRAEIIAKFARAENDTGSPEVQVALLTAQINDLQGHFKAHKHDHH
SRRGLIRMVNQRRKLLDYLNGKDHERYTALIGALGLRR
3D structure
PDB6v39 Cryo-electron Microscopy Structure of the Acinetobacter baumannii 70S Ribosome and Implications for New Antibiotic Development.
Chaino
Resolution3.04 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna o Q40 L56 V60 R89 Q39 L55 V59 R88
BS02 rna o A2 N5 R8 N20 D21 T22 G23 S24 L39 H42 H46 H48 D49 S52 R54 K65 Y69 A1 N4 R7 N19 D20 T21 G22 S23 L38 H41 H45 H47 D48 S51 R53 K64 Y68
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6v39, PDBe:6v39, PDBj:6v39
PDBsum6v39
PubMed31964740
UniProtB7I3U0|RS15_ACIB5 Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]