Structure of PDB 6tnn Chain o

Receptor sequence
>6tnno (length=82) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
SKKGVGSTKNGRDSEAKRLGAKRADGQFVTGGSILYRQRGTKIYPGENVG
RGGDDTLFAKIDGTVKFERFGRDRKKVSVYPV
3D structure
PDB6tnn Structures of B. subtilis Maturation RNases Captured on 50S Ribosome with Pre-rRNAs.
Chaino
Resolution3.07 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna o K12 G16 K19 N20 R22 D23 S24 E25 K27 R28 A34 D35 G41 G42 I44 Y46 R47 R49 G50 Y54 G62 G63 D64 F68 F77 R84 K85 K2 G6 K9 N10 R12 D13 S14 E15 K17 R18 A24 D25 G31 G32 I34 Y36 R37 R39 G40 Y44 G52 G53 D54 F58 F67 R74 K75
BS02 rna o R79 R82 R69 R72
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6tnn, PDBe:6tnn, PDBj:6tnn
PDBsum6tnn
PubMed32991829
UniProtP05657|RL27_BACSU Large ribosomal subunit protein bL27 (Gene Name=rpmA)

[Back to BioLiP]