Structure of PDB 6qtz Chain o

Receptor sequence

>6qtzo (length=325) Species: 4932 (Saccharomyces cerevisiae)

DLIVPRRPEWNEGMSKFQLDRQEKEAFLEWRRKLAHLQESNEDLLLTPFE
RNIEVWKQLWRVVERSDLVVQIVDARNPLLFRSVDLERYVKESDDRKANL
LLVNKADLLTKKQRIAWAKYFISKNISFTFYSALRANQVMEKVKILSIDI
NIGLVGYPNVGKSSTINSLVGAKKVSVSSTPGKTKHFQTIKLSDSVMLCD
CPGLVFPNFAYNKGELVCNGVLPIDQLRDYIGPAGLVAERIPKYYIEAIY
GIHIQTKSRDEGGNGDIPTAQELLVAYARARGYMTQGYGSADEPRASRYI
LKDYVNGKLLYVNPPPHLEDDTPYT

3D structure

• PDB: 6qtz Mechanism of completion of peptidyltransferase centre assembly in eukaryotes.
• Chain: o
• Resolution: 3.5 Å

Enzymatic activity

• Enzyme Commision number: 3.6.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	o	W142 G145 M146 S147 K148 D152 R193 E196 K360 K361 V362 S363 H373 F374 Q375 T376 K378 D412 Q413 R415 Y417 R468 G469 Y470 T472 Q473 G474 Y475 G476 D479 R482	W10 G13 M14 S15 K16 D20 R61 E64 K173 K174 V175 S176 H186 F187 Q188 T189 K191 D225 Q226 R228 Y230 R281 G282 Y283 T285 Q286 G287 Y288 G289 D292 R295

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003924 GTPase activity
• GO:0005515 protein binding
• GO:0005525 GTP binding
• GO:0016787 hydrolase activity

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0000054 ribosomal subunit export from nucleus
• GO:0015031 protein transport

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0022625 cytosolic large ribosomal subunit
• GO:0043332 mating projection tip

External links

• PDB: RCSB:6qtz, PDBe:6qtz, PDBj:6qtz
• PDBsum: 6qtz
• PubMed: 31115337
• UniProt: P53145|LSG1_YEAST Large subunit GTPase 1 (Gene Name=LSG1)