Structure of PDB 6nu2 Chain o

Receptor sequence
>6nu2o (length=94) Species: 9606 (Homo sapiens) [Search protein sequence]
RGRIPGRQWIGKHRRPRFVSLRAKQNMIRRLEIEAENHYWLSMPYMTREQ
ERGHAAVRRREAFEAIKAAATSKFPPHRFIADQLDHLNVTKKWS
3D structure
PDB6nu2 Structural insights into unique features of the human mitochondrial ribosome recycling.
Chaino
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna o R9 G10 R11 P13 G14 R15 Q16 W17 I18 K20 R25 F26 S28 R30 A31 N34 R56 E59 R60 G61 H62 A63 A64 R66 R67 F71 I74 K75 K81 K100 R1 G2 R3 P5 G6 R7 Q8 W9 I10 K12 R17 F18 S20 R22 A23 N26 R48 E51 R52 G53 H54 A55 A56 R58 R59 F63 I66 K67 K73 K92
BS02 MG o P13 G14 P5 G6
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005761 mitochondrial ribosome
GO:0005762 mitochondrial large ribosomal subunit
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6nu2, PDBe:6nu2, PDBj:6nu2
PDBsum6nu2
PubMed30962385
UniProtQ9BQC6|RT63_HUMAN Large ribosomal subunit protein mL63 (Gene Name=MRPL57)

[Back to BioLiP]