Structure of PDB 6gq1 Chain o

Receptor sequence

>6gq1o (length=105) Species: 559292 (Saccharomyces cerevisiae S288C)

VNVPKTRKTYCKGKTCRKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGFG
GQTKPVFHKKAKTTKKVVLRLECVKCKTRAQLTLKRCKHFELGGEKKQKG
QALQF

3D structure

• PDB: 6gq1 Structural Insights into the Role of Diphthamide on Elongation Factor 2 in mRNA Reading-Frame Maintenance.
• Chain: o
• Resolution: 4.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	o	V2 N3 P5 R8 K9 T10 Y11 K13 K19 H20 A30 A33 F36 Q38 G39 R41 R42 R45 K46 G49 F50 Q53 T54 K55 P56 V57 F58 K60 A62 K63 K66 K67 R71 T79 R80 L85 K86 C88 K89 K97 K98	V1 N2 P4 R7 K8 T9 Y10 K12 K18 H19 A29 A32 F35 Q37 G38 R40 R41 R44 K45 G48 F49 Q52 T53 K54 P55 V56 F57 K59 A61 K62 K65 K66 R70 T78 R79 L84 K85 C87 K88 K96 K97
BS02	rna	o	Y43 K55 V57	Y42 K54 V56
BS03	ZN	o	C12 C74 C77	C11 C73 C76

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0008270 zinc ion binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0046677 response to antibiotic
• GO:0046898 response to cycloheximide

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0044391 ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6gq1, PDBe:6gq1, PDBj:6gq1
• PDBsum: 6gq1
• PubMed: 29886014
• UniProt: P0CX27|RL44A_YEAST Large ribosomal subunit protein eL42A (Gene Name=RPL42A)