Structure of PDB 5wfs Chain o

Receptor sequence
>5wfso (length=88) Species: 562 (Escherichia coli) [Search protein sequence]
SLSTEATAKIVSEFGRDANDTGSTEVQVALLTAQINHLQGHFAEHKKDHH
SRRGLLRMVSQRRKLLDYLKRKDVARYTQLIERLGLRR
3D structure
PDB5wfs Cryo-EM shows stages of initial codon selection on the ribosome by aa-tRNA in ternary complex with GTP and the GTPase-deficient EF-TuH84A.
Chaino
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna o Q39 L56 V59 R88 Q39 L56 V59 R88
BS02 rna o S1 T4 N19 D20 T21 G22 Q27 Q34 H37 H41 H45 K47 D48 H49 H50 S51 R53 G54 S60 K64 Y68 S1 T4 N19 D20 T21 G22 Q27 Q34 H37 H41 H45 K47 D48 H49 H50 S51 R53 G54 S60 K64 Y68
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006417 regulation of translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5wfs, PDBe:5wfs, PDBj:5wfs
PDBsum5wfs
PubMed29733411
UniProtP0ADZ4|RS15_ECOLI Small ribosomal subunit protein uS15 (Gene Name=rpsO)

[Back to BioLiP]