Structure of PDB 5t62 Chain o

Receptor sequence
>5t62o (length=58) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
AKSKNHTAHNQTRKAHRNGIKKPKTYKYPSLKGVDPKFRRNHKHALHGTA
KALAAAKK
3D structure
PDB5t62 Nmd3 is a structural mimic of eIF5A, and activates the cpGTPase Lsg1 during 60S ribosome biogenesis.
Chaino
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna o A2 K3 K5 N6 H7 T8 H10 N11 Q12 T13 R14 K15 H17 R18 N19 K25 T26 Y27 Y29 S31 L32 K33 D36 K38 R41 N42 H43 K44 A46 G49 T50 A1 K2 K4 N5 H6 T7 H9 N10 Q11 T12 R13 K14 H16 R17 N18 K24 T25 Y26 Y28 S30 L31 K32 D35 K37 R40 N41 H42 K43 A45 G48 T49
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5t62, PDBe:5t62, PDBj:5t62
PDBsum5t62
PubMed28179369
UniProtP05747|RL29_YEAST Large ribosomal subunit protein eL29 (Gene Name=RPL29)

[Back to BioLiP]