Structure of PDB 5t5h Chain o

Receptor sequence

>5t5ho (length=85) Species: 5693 (Trypanosoma cruzi) [Search protein sequence]

KRTVKMGVMGRYGARYGANPRKRAKKLEVSQHARHFCSFCGKFAFRRKAV
GIWRCDGCSKTMAGGAYTLSTPNNSTVRSTVRRLR

3D structure

PDB

5t5h Structure and assembly model for the Trypanosoma cruzi 60S ribosomal subunit.

Chain

Resolution

2.54 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	o	K3 R4 T5 G9 V10 G12 R13 R17 Y18	K1 R2 T3 G7 V8 G10 R11 R15 Y16
BS02	rna	o	T5 V6 K7 M8 G15 A16 R17 Y18 G19 A20 N21 P22 R23 F41 K62	T3 V4 K5 M6 G13 A14 R15 Y16 G17 A18 N19 P20 R21 F39 K60
BS03	rna	o	E30 Q33 H34 R36 F41 R49 K50 A51 V52 Y69	E28 Q31 H32 R34 F39 R47 K48 A49 V50 Y67
BS04	ZN	o	C39 C42 C57	C37 C40 C55

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

External links