Structure of PDB 5opt Chain o

Receptor sequence

>5opto (length=140) Species: 353153 (Trypanosoma cruzi strain CL Brener) [Search protein sequence]

IRRIGKKKGATMKDVHPWRWVKLCSQHFKQEGKLMVPNCTEIVKSSHGRE
RAPQNPDWYYIRCAAILRAVYMRPGVGYGGLSKRFSNKKNRGSRPEITVR
ASKGLLHWGCKSLTKLGLIEKCESSGHRITKNGRKLADAI

3D structure

PDB

5opt The cryo-EM Structure of a Novel 40S Kinetoplastid-Specific Ribosomal Protein.

Chain

Resolution

4.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	o	I12 R13 A21 T22 Q41 E42 M46 N49 V54 S56 H58 R73 A75 A76 I77 R79 A80 V81 Y82 M83 P85 G86 V87 G88 Y89 S93 K94 F96 S97 N98 K99 N101 R102 G103 S104 R105 P106 E107 V110 R111 S113 K114 I130 E134 H138 R139 K142 N143 K146 L147 D149	I1 R2 A10 T11 Q30 E31 M35 N38 V43 S45 H47 R62 A64 A65 I66 R68 A69 V70 Y71 M72 P74 G75 V76 G77 Y78 S82 K83 F85 S86 N87 K88 N90 R91 G92 S93 R94 P95 E96 V99 R100 S102 K103 I119 E123 H127 R128 K131 N132 K135 L136 D138

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000028	ribosomal small subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links